PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G02240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 787aa    MW: 84547 Da    PI: 6.3334
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G02240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-21115170156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  OGLUM08G02240.1 115 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 170
                      688999***********************************************999 PP

2START203.11.2e-632915171206
                      HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                      ela +a++elv++a+++ep+W      e ++++e+ ++f+++ +      ++ea+r+++vv+m+++ lve l+d++ qW+  +     +a+tle
  OGLUM08G02240.1 291 ELAVAAMEELVRMAQLGEPLWAPALggEALDEEEYARTFPRGLGpkspeLRSEASRETAVVIMNHVSLVEMLMDVG-QWTALFSsivsRAATLE 383
                      57899**********************************99888********************************.99999999999****** PP

                      EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EE.SSEEEEEEEECTCEEEEEE CS
            START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRael.lpSgiliepksnghskvtw 166
                      v+s+g      galqlm+ae+q++splvp R+  f+Ry++q+++g+w++vdvS+d  +       ++  +R+++ +pSg+li++++ng+skvtw
  OGLUM08G02240.1 384 VLSTGvagnhnGALQLMSAEFQMPSPLVPtRETQFLRYCKQHPDGTWAVVDVSLDGLRAGAGggcQPAAARGHRrRPSGCLIQEMPNGYSKVTW 477
                      ************************************************************9999********8537****************** PP

                      EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      vehv+ +++++h+l++++v+sg+a+ga++wvatl+rqce+
  OGLUM08G02240.1 478 VEHVEADDQMVHNLYKPVVNSGMAFGARRWVATLERQCER 517
                      **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-23101170IPR009057Homeodomain-like
SuperFamilySSF466892.51E-20102172IPR009057Homeodomain-like
PROSITE profilePS5007117.394112172IPR001356Homeobox domain
SMARTSM003891.1E-20113176IPR001356Homeobox domain
CDDcd000867.48E-20114173No hitNo description
PfamPF000462.4E-18115170IPR001356Homeobox domain
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
PROSITE profilePS5084843.25282520IPR002913START domain
SuperFamilySSF559617.19E-34283519No hitNo description
CDDcd088753.85E-120286516No hitNo description
SMARTSM002349.5E-61291517IPR002913START domain
PfamPF018522.1E-53292517IPR002913START domain
Gene3DG3DSA:3.30.530.203.9E-5357516IPR023393START-like domain
SuperFamilySSF559615.5E-26537760No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MSPAMIGRPN GGGGVAYASS SSALSLGQSL LDGHHHQLPS LLQQHHNGHH LLDQHQQHQH  60
QLPPQATTTS ESDGRAPRDE LEMSKSGGSD NLESGGGGGG GGSGDDQDPN QRPRKKRYHR  120
HTQHQIQELE AFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK TQHERHENNA  180
LRAENEKLRA ENMRYKEALA NASCPNCGGP AAIGEMSFDE HHLRLENARL RDEIDRISAI  240
AAKYVGKPAA AVSAAYPPLP PSNRSPLDHM GIPGAGADVF GADFDKPLVI ELAVAAMEEL  300
VRMAQLGEPL WAPALGGEAL DEEEYARTFP RGLGPKSPEL RSEASRETAV VIMNHVSLVE  360
MLMDVGQWTA LFSSIVSRAA TLEVLSTGVA GNHNGALQLM SAEFQMPSPL VPTRETQFLR  420
YCKQHPDGTW AVVDVSLDGL RAGAGGGCQP AAARGHRRRP SGCLIQEMPN GYSKVTWVEH  480
VEADDQMVHN LYKPVVNSGM AFGARRWVAT LERQCERLAS AMASNVASSG DAGVITTSEG  540
RRSMLKLAER MVASFCGGVT ASTTHQWTTL SGSGAEDVRV MTRKSVDDPG RPPGIILNAA  600
TSFWLPVPPS RVFDFLRDDS TRSEWDILSN GGVVQEMAHI ANGRDHGNAV SLLRVNNANS  660
NQSNMLILQE CCTDATGSYV IYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPDGGG  720
GSLLTVAFQI LVDSVPTAKL SLGSVATVNS LIACTVERIK AAITGDNGVA PPCPRGSREG  780
SRANSEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185630.0AK318563.1 Oryza sativa Japonica Group cDNA, clone: J075197C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648539.10.0PREDICTED: homeobox-leucine zipper protein ROC7
SwissprotA2YR020.0ROC7_ORYSI; Homeobox-leucine zipper protein ROC7
TrEMBLA0A0E0AQJ90.0A0A0E0AQJ9_9ORYZ; Uncharacterized protein
STRINGORGLA08G0016400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2